Hart RK, Prliฤ A (2020) SeqRepo: A system for managing local collections of biological sequences. PLoS ONE 15(12): e0239883. https://doi.org/10.1371/journal.pone.0239883
Provides SeqRepo and GA4GH RefGet REST interfaces to biological sequences and sequence metadata from an existing seqrepo sequence repository.
Specific, named biological sequences provide the reference and coordinate sysstem for communicating variation and consequential phenotypic changes. Several databases of sequences exist, with significant overlap, all using distinct names. Furthermore, these systems are often difficult to install locally.
Clients refer to sequences and metadata using familiar identifiers, such as NM_000551.3 or GRCh38:1, or any of several hash-based identifiers. The interface supports fast slicing of arbitrary regions of large sequences.
A "fully-qualified" identifier includes a namespace to disambiguate accessions (e.g., "1" in GRCh37 and GRCh38). If the namespace is provided, seqrepo uses it as-is. If the namespace is not provided and the unqualified identifier refers to a unique sequence, it is returned; otherwise, ambiguous identifiers will raise an error.
SeqRepo favors identifiers from identifiers.org whenever available. Examples include refseq and ensembl.
This repository is the REST interface only. The underlying data is provided by seqrepo.
This repository also implements the GA4GH refget (v1)
protocol at
<baseurl>/refget/.
This project is a product of the biocommons community.
- Github repository: https://github.com/biocommons/seqrepo-rest-service/
- Documentation https://biocommons.github.io/seqrepo-rest-service/
Install from PyPI with pip install seqrepo-rest-service or uv pip install seqrepo-rest-service
These tools are required to get started:
- git: Version control system
- GNU make: Current mechanism for consistent invocation of developer tools.
- uv: An extremely fast Python package and project manager, written in Rust.
- Install brew
brew install git make uv
You may also install using distribution packages:
sudo apt install git make
Then install uv using the uv installation instructions.
The REST interface is implemented with OpenAPI. Current and interactive documentation is available at the base url for the endpoint.
Fetch sequence by an accession:
$ curl -f http://0.0.0.0:5000/seqrepo/1/sequence/NP_001274413.1
MERSFVWLSCLDSDSCNLTFRLGEVESHACSPSLLWNLLTQYLPPGAGHILRTYNFPVLSCVSSCHLIGGKMPEN
Or not:
$ curl -f http://0.0.0.0:5000/seqrepo/1/sequence/bogus
curl: (22) The requested URL returned error: 404 NOT FOUND
Popular digests are also available:
$ curl -f http://0.0.0.0:5000/seqrepo/1/sequence/MD5:d52770ec477d0c9ee01fa034aff62cb4
MERSFVWLSCLDSDSCNLTFRLGEVESHACSPSLLWNLLTQYLPPGAGHILRTYNFPVLSCVSSCHLIGGKMPEN
With range:
# ๐ Seqrepo uses interbase coordinates.
$ curl -f "http://0.0.0.0:5000/seqrepo/1/sequence/NP_001274413.1?start=5&end=10"
VWLSC
$ curl -f "http://0.0.0.0:5000/seqrepo/1/metadata/GRCh38:1"
{
"added": "2016-08-27T21:17:00Z",
"aliases": [
"GRCh38:1",
"GRCh38:chr1",
"GRCh38.p1:1",
"GRCh38.p1:chr1",
โฎ
"GRCh38.p9:chr1",
"MD5:6aef897c3d6ff0c78aff06ac189178dd",
"refseq:NC_000001.11",
"SEGUID:FCUd6VJ6uikS/VWLbhGdVmj2rOA",
"SHA1:14251de9527aba2912fd558b6e119d5668f6ace0",
"sha512t24u:Ya6Rs7DHhDeg7YaOSg1EoNi3U_nQ9SvO",
"ga4gh:SQ.Ya6Rs7DHhDeg7YaOSg1EoNi3U_nQ9SvO"
],
"alphabet": "ACGMNRT",
"length": 248956422
}
Create a Python virtual environment, install dependencies, install pre-commit hooks, and install an editable package:
make devready
N.B. Developers are strongly encouraged to use make to invoke tools to
ensure consistency with the CI/CD pipelines. Type make to see a list of
supported targets. A subset are listed here:
ยป make
๐๐ biocommons conventional make targets ๐๐
Using these targets promots consistency between local development and ci/cd commands.
usage: make [target ...]
BASIC USAGE
help Display help message
SETUP, INSTALLATION, PACKAGING
devready Prepare local dev env: Create virtual env, install the pre-commit hooks
build Build package
publish publish package to PyPI
FORMATTING, TESTING, AND CODE QUALITY
cqa Run code quality assessments
test Test the code with pytest
DOCUMENTATION
docs-serve Build and serve the documentation
docs-test Test if documentation can be built without warnings or errors
CLEANUP
clean Remove temporary and backup files
cleaner Remove files and directories that are easily rebuilt
cleanest Remove all files that can be rebuilt
distclean Remove untracked files and other detritus
Once installed as above, you should be able to:
$ seqrepo-rest-service /usr/local/share/seqrepo/2024-12-20
The navigate to the URL shown in the console output.
A docker image can be built with this repo or pulled from docker hub. In either case, the container requires an existing local seqrepo sequence repository.
To build a docker image in this repo:
make docker-image
This will create biocommons/seqrepo-rest-service:latest, like this:
$ docker images
REPOSITORY TAG IMAGE ID CREATED SIZE
biocommons/seqrepo-rest-service latest ad9ca051c5c9 2 minutes ago 627MB
This docker image is periodically pushed to docker hub.
Invoke the docker image like this this:
docker run \
--name seqrepo-rest-service \
--detach --rm -p 5000:5000 \
-v /usr/local/share/seqrepo/2024-12-20:/mnt/seqrepo \
biocommons/seqrepo-rest-service \
seqrepo-rest-service /mnt/seqrepo
Where the command line options are as follows:
--name seqrepo-rest-service:Assigns the nameseqrepo-rest-serviceto the container--detach:Runs the container in background and prints the container ID--rm:Automatically removes the container when it exits-p 5000:5000:Publishes a containerโs port(s),5000:5000, to the local host-v /usr/local/share/seqrepo/2024-12-20:/mnt/seqrepo: Binds the local volume,/usr/local/share/seqrepo/2024-12-20to the address/mnt/seqrepowithin the containerbiocommons/seqrepo-rest-service:Specifies the docker image (as built above)seqrepo-rest-service:Specifies the console name or entry pointseqrepo_rest_service.cli:main/mnt/seqrepo:Specifies the SeqRepo instance directory, as corresponding to the volume above
You should then be able to fetch a test sequence like this:
$ curl 'http://127.0.0.1:5000/seqrepo/1/sequence/refseq:NM_000551.3?end=20'
CCTCGCCTCCGTTACAACGG
If things aren't working, check the logs with docker logs -f seqrepo-rest-service.
